PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000507805
Common NameLOC103407650, WRKY13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 465aa    MW: 51548.9 Da    PI: 8.15
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000507805genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.2e-33124181260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDg+nWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  MDP0000507805 124 DDGFNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 181
                    8****************************************.***************85 PP

2WRKY105.92e-33296354159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  MDP0000507805 296 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDIRAVITTYEGKHNHD 354
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-29116182IPR003657WRKY domain
SuperFamilySSF1182901.83E-25122182IPR003657WRKY domain
SMARTSM007745.2E-37123181IPR003657WRKY domain
PROSITE profilePS5081123.456124182IPR003657WRKY domain
PfamPF031068.8E-26124180IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37281356IPR003657WRKY domain
SuperFamilySSF1182902.48E-29288356IPR003657WRKY domain
PROSITE profilePS5081138.561291356IPR003657WRKY domain
SMARTSM007743.7E-39296355IPR003657WRKY domain
PfamPF031069.8E-26297354IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MLQTYTLPSP TTGSFAARGA FNWKNNQQNV KQESKNHSDF SFQTQARPPI SSSSSMFQSS  60
NTSIQTTQEQ ACNNNYFQAQ ELPKQEYGSV QTLSSELTTK TLQSNAPANG GFHQQAQTLS  120
RKSDDGFNWR KYGQKQVKGS ENPRSYYKCT YPNCPTKKKV ERSLDGQITE IVYKGNHNHP  180
KPQNPRKSSS NSHAIHALNP TNTNEIPDQT YANHGNSQMD SIGTPEHSSI SIGDDDFEQS  240
SQRSKSGGGE EFDEDEPNAK XWKNEADHNE GISAPGNRTV REPRVVVQTT SDIDILDDGY  300
RWRKYGQKVV KGNPNPRSYY KCTNPGCPVR KHVERASHDI RAVITTYEGK HNHDVPAARG  360
SGSHAAVNRP IPNNNNNVAS AMRPITHHTN NSANTNSVQN LRQPTSEGQA PFSLEMLQSP  420
GSYGFVGFDG NSVGSYMNQT QLSDIFSKAK EEPRDDAFFE SLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-38124357878Probable WRKY transcription factor 4
2lex_A2e-38124357878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158570.0cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344767.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-112WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLD9ZJF20.0D9ZJF2_MALDO; WRKY domain class transcription factor
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-111WRKY DNA-binding protein 33